Dash of ChefDash of Chef
← Back to recipes
Snickers-flavored Protein Smoothie
north americandairy freegluten freebreakfastdrinkssnacksmealdietaryvegetarian

Snickers-flavored Protein Smoothie

By Tasty5 min1 servings

Satisfy your sweet tooth while staying healthy with this Snickers-flavored protein smoothie. It's a delightful blend of chocolate, peanut butter, and caramel that'll make you forget you're actually drinking something nutritious!

Instructions

  1. 1

    Add Plain Greek Yogurt.

  2. 2

    Add almond milk.

  3. 3

    Add chocolate protein powder.

  4. 4

    Add creamy peanut butter.

  5. 5

    Add unsweetened cocoa powder.

  6. 6

    Add sugar-free caramel syrup.

  7. 7

    Add ice (add more for thicker consistency). Process until well pureed.

  8. 8

    Feel free to top off the smoothie with peanuts, caramel syrup, and chocolate syrup to taste.

  9. 9

    Enjoy!

Recipe from tasty.co

Comments

500
Loading comments...

Ingredients delivered in ~45 min

via Instacart from 1,400+ stores

Save it for next time

Save this recipe to your account
Shop it again in one tap
Make it a recurring order
Create free account
Rate this recipe
0
Like or save this recipe

Ingredients (10)

  • ½ cup plain greek yogurt
  • ½ cup almond milk
  • ⅓ cup chocolate protein powder
  • ¼ cup creamy peanut butter
  • 1 tablespoon unsweetened cocoa powder
  • 2 teaspoons sugar-free caramel syrup
  • 1 ½ cups ice, more if you want thicker consistency
  • sugar-free caramel syrup, for drizzle, as desired
  • sugar-free chocolate syrup, to taste
  • peanut, to taste

Cook next with these ingredients

These recipes use most of what’s already in this cart.